PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000129335
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 351aa    MW: 39924.3 Da    PI: 6.4473
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000129335genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.96.7e-56161421129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeel+++yL +kv ++ + + ++i evd++k+ePwdLp k+k +e+ewyfF+ +d+ky+tg r+nrat++gyWkatgkdke+++  
  MDP0000129335  16 LPPGFRFHPTDEELISHYLSPKVLDNFFCA-RAIGEVDLNKCEPWDLPWKAKMGEREWYFFCVKDRKYPTGLRTNRATEAGYWKATGKDKEIYK-A 109
                    79************************9888.89***************888999****************************************.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                    ++lvg+kktLvfy+grapkg+kt+Wvmheyrle
  MDP0000129335 110 KTLVGMKKTLVFYEGRAPKGVKTNWVMHEYRLE 142
                    99*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-6512166IPR003441NAC domain
PROSITE profilePS5100559.62116166IPR003441NAC domain
PfamPF023656.1E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MENTSGFIME DEQMELPPGF RFHPTDEELI SHYLSPKVLD NFFCARAIGE VDLNKCEPWD  60
LPWKAKMGER EWYFFCVKDR KYPTGLRTNR ATEAGYWKAT GKDKEIYKAK TLVGMKKTLV  120
FYEGRAPKGV KTNWVMHEYR LEGESSAHNL PKTTKNEWVI CRIFQKSSGG KKTHISGLLR  180
PSPFGNELRS XLLPPLMDSP AYNSDARTTT TACETSHVSC FSDPAEDQKT EDDIMDSFNN  240
SNNHHHHNNI HFASSSXSNP SAHLNTFYSN QITPNIGLLQ HQNSVLMLDQ SLSRMLVENQ  300
APNLRRSAKI EFSPDTGLSI DASSVVSNRE MVQDDPSYSS APIELDGLWY Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-551317214171NAC domain-containing protein 19
4dul_A1e-551317214171NAC domain-containing protein 19
1ut7_B1e-551317214171NO APICAL MERISTEM PROTEIN
1ut7_A1e-551317214171NO APICAL MERISTEM PROTEIN
1ut4_B1e-551317214171NO APICAL MERISTEM PROTEIN
1ut4_A1e-551317214171NO APICAL MERISTEM PROTEIN
3swp_D2e-551317217174NAC domain-containing protein 19
3swp_C2e-551317217174NAC domain-containing protein 19
3swp_B2e-551317217174NAC domain-containing protein 19
3swp_A2e-551317217174NAC domain-containing protein 19
3swm_D2e-551317217174NAC domain-containing protein 19
3swm_C2e-551317217174NAC domain-containing protein 19
3swm_B2e-551317217174NAC domain-containing protein 19
3swm_A2e-551317217174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.128910.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1774230.0FJ177423.1 Malus x domestica NAC domain protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341588.10.0PREDICTED: NAC domain-containing protein 100
RefseqXP_008353426.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-126NC100_ARATH; NAC domain-containing protein 100
TrEMBLB6DXL40.0B6DXL4_MALDO; NAC domain class transcription factor
STRINGVIT_14s0108g01070.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-125NAC domain containing protein 100